PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_58950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 300aa    MW: 32771.1 Da    PI: 7.468
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_58950.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM102.27.2e-32259954128
           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++ ew+fF++rd+ky++g+r+nrat++gyWkatgkd++v + +g++ g++ktLvfykgrap ge+tdWvmheyrl
  MLOC_58950.1  25 RDLEWFFFVPRDRKYPNGSRTNRATTTGYWKATGKDRKVSCDGGAVCGVRKTLVFYKGRAPGGERTDWVMHEYRL 99 
                   5669*********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.3231122IPR003441NAC domain
PfamPF023651.2E-152399IPR003441NAC domain
SuperFamilySSF1019411.23E-3624121IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MRMLRFRVVL CVFGYFSEKS FLPKRDLEWF FFVPRDRKYP NGSRTNRATT TGYWKATGKD  60
RKVSCDGGAV CGVRKTLVFY KGRAPGGERT DWVMHEYRLC QDLLHGASNF IGAYALCRVI  120
KRTEAGLLHG DAAAKAKPCH QQMTKVGSSS SLVTTDQQLG SLTPSPPRLD IVGNAFQLHT  180
SPSPLYGGEV VSGMGAPLGF PQQDAAATFF VDADLAGAGE TTQSHMPFFG DMGVVSDHEL  240
RWDTLPPYAN NTFSTTAVAG AAELWNPAAP NAAAPMLCRE ESDDLAAFFS SLDENNMVVY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-312212562168NO APICAL MERISTEM PROTEIN
1ut4_B2e-312212562168NO APICAL MERISTEM PROTEIN
1ut7_A2e-312212562168NO APICAL MERISTEM PROTEIN
1ut7_B2e-312212562168NO APICAL MERISTEM PROTEIN
3swm_A2e-312212565171NAC domain-containing protein 19
3swm_B2e-312212565171NAC domain-containing protein 19
3swm_C2e-312212565171NAC domain-containing protein 19
3swm_D2e-312212565171NAC domain-containing protein 19
3swp_A2e-312212565171NAC domain-containing protein 19
3swp_B2e-312212565171NAC domain-containing protein 19
3swp_C2e-312212565171NAC domain-containing protein 19
3swp_D2e-312212565171NAC domain-containing protein 19
4dul_A2e-312212562168NAC domain-containing protein 19
4dul_B2e-312212562168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689850.0AK368985.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2083F05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235019.21e-108PREDICTED: NAC domain-containing protein 72-like
TrEMBLM0XCW50.0M0XCW5_HORVD; Uncharacterized protein
STRINGMLOC_58950.30.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.16e-49NAC domain containing protein 71